| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | (pT)DGSTTPAYAHGQHHSIFSPATGAVSDSSLK | 1069.8173 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | (pT)DGSTTPAYAHGQHHSIFSPATGAVSDSSLK | 1069.817462 | 3 | 1 | 23111157 | 0.0156059 | XCorr | 3.932 | 9 days | total protein | col-0 | continuous light | in-solution | Ti-IMAC | trypsin | | LTQ | seedlings | nitrate starvation / nitrate resupply |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | (pT)DGSTTPAYAHGQHHSIFSPATGAVSDSSLK | 897.3348 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | (pT)DGSTTPAYAHGQHHSIFSPATGAVSDSSLK | 1069.81946 | 3 | 1 | 24601666 | | Mascot_Score | 56.25 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | (pT)DGSTTPAYAHGQHHSIFSPATGAVSDSSLK | 614.8079 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |