| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| ELAAEESDGSVKEDDDDDEDSSESGKSEMVNPSFA | ELAAEE(pS)DG(pS)VKEDDDDDEDSSESGKSEMVNPSFA | 1294.15063 | 3 | 1 | 24601666 | | Mascot_Score | 44.57 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| ELAAEESDGSVKEDDDDDEDSSESGKSEMVNPSFA | ELAAEE(pS)DG(pS)VKEDDDDDEDSSESGKSEMVNPSFA | 471.1803 | 3 | 2 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| ELAAEESDGSVKEDDDDDEDSSESGKSEMVNPSFA | ELAAEE(pS)DG(pS)VKEDDDDDEDSSESGKSEMVNPSFA | 900.082 | 3 | 2 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| ELAAEESDGSVKEDDDDDEDSSESGKSEMVNPSFA | ELAAEE(pS)DG(pS)VKEDDDDDEDSSESGKSEMVNPSFA | 811.3608 | 3 | 2 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| ELAAEESDGSVKEDDDDDEDSSESGKSEMVNPSFA | ELAAEE(pS)DG(pS)VKEDDDDDEDSSESGKSEMVNPSFA | 1362.5466 | 3 | 2 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |