| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 772.3364 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.3057 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 655.5595 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 678.8303 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.61627 | 4 | 1 | 24601666 | | Mascot_Score | 30.74 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.3026 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 869.4011 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 586.6009 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.6154 | 4 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 678.8304 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.6152 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.3025 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 667.5667 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 678.83 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 678.8305 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 778.349 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 838.0608 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.61578 | 4 | 1 | 24601666 | | Mascot_Score | 64.57 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 834.6386 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.617 | 4 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 869.4033 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 1069.81897 | 3 | 1 | 24601666 | | Mascot_Score | 18.67 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 655.5573 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 633.5869 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.3023 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.3046 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 1069.8176 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 682.971 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 873.7405 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 633.5887 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.61591 | 4 | 1 | 24601666 | | Mascot_Score | 39.64 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 732.3406 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 834.6395 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 838.0631 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 1135.6902 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.3024 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.303 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 678.8314 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 697.8379 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 652.3029 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 801.8738 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.6137 | 4 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.615 | 4 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.6154 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.61603 | 4 | 1 | 24601666 | | Mascot_Score | 34.49 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.6163 | 4 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 678.8296 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 802.6161 | 4 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 901.8492 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 701.6492 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| TDGSTTPAYAHGQHHSIFSPATGAVSDSSLK | TDGST(pT)PAYAHGQHHSIFSPATGAVSDSSLK | 901.85 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |