Home Bulk Downloads Data submission Background P-Hotspots Kinome Facts & Figures Database Imprint

Modifications:

modType	position	affAmin
phos	32	S

sequence	modifiedsequence	mcr	charge	No.pSTY	PubMed	ppm	score_Type	score	age	CellCompartment	Cultivar	DayNight	DigestionProcess	Enrichment	Enzyme	GrowthChamber	Instrument	Tissue	Treatment
TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR	TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR	812.05518	6	1	24601666		Mascot_Score	42.36	4 weeks	total protein	col-0	16h light/8h dark	in-solution	IMAC	trypsin		LTQ-Orbitrap XL ETD	seedlings	flg22
TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR	TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR	953.9608	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR	TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR	974.2674	5	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR	TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR	974.2666	5	1	24601666		Mascot_Score	32.6	4 weeks	total protein	col-0	16h light/8h dark	in-solution	IMAC	trypsin		LTQ-Orbitrap XL ETD	seedlings	flg22
TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR	TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR	974.26739	5	1	24601666		Mascot_Score	21.46	4 weeks	total protein	col-0	16h light/8h dark	in-solution	IMAC	trypsin		LTQ-Orbitrap XL ETD	seedlings	flg22
TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDDSPIHGREESLVR	TLSKYEEMNKPSAPLTSHEPAMIPVAEEPDD(pS)PIHGREESLVR	721.5804	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22