sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 974.2666 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 1193.21594 | 3 | 1 | 24601666 | | Mascot_Score | 33.36 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 895.16589 | 4 | 1 | 24601666 | | Mascot_Score | 41.47 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 1115.4904 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 1019.0885 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 891.4226 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 607.0529 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 888.4149 | 5 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 651.8398 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR | TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR | 1193.21948 | 3 | 1 | 24601666 | | Mascot_Score | 44.22 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |