Home Bulk Downloads Data submission Background P-Hotspots Kinome Facts & Figures Database Imprint

Modifications:

modType	position	affAmin
phos	18	S

sequence	modifiedsequence	mcr	charge	No.pSTY	PubMed	ppm	score_Type	score	age	CellCompartment	Cultivar	DayNight	DigestionProcess	Enrichment	Enzyme	GrowthChamber	Instrument	Tissue	Treatment
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	974.2666	5	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	1193.21594	3	1	24601666		Mascot_Score	33.36	4 weeks	total protein	col-0	16h light/8h dark	in-solution	IMAC	trypsin		LTQ-Orbitrap XL ETD	seedlings	flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	895.16589	4	1	24601666		Mascot_Score	41.47	4 weeks	total protein	col-0	16h light/8h dark	in-solution	IMAC	trypsin		LTQ-Orbitrap XL ETD	seedlings	flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	1115.4904	3	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	1019.0885	3	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	891.4226	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	607.0529	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	888.4149	5	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	651.8398	4	1	29167316		Mascot_Score	0	14 days	total protein	col-0 and mpk mutants		in-solution	Fe-IMAC	trypsin				flg22
TVEQTTLTEDNRFSTVGSDSDEYNPTLPKPR	TVEQTTLTEDNRFSTVG(pS)DSDEYNPTLPKPR	1193.21948	3	1	24601666		Mascot_Score	44.22	4 weeks	total protein	col-0	16h light/8h dark	in-solution	IMAC	trypsin		LTQ-Orbitrap XL ETD	seedlings	flg22