| sequence |
modifiedsequence |
mcr |
charge |
No.pSTY |
PubMed |
ppm |
score_Type |
score |
age |
CellCompartment |
Cultivar |
DayNight |
DigestionProcess |
Enrichment |
Enzyme |
GrowthChamber |
Instrument |
Tissue |
Treatment |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 747.7871 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 917.4089 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1294.15 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 795.8889 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 983.8966 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4712 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4717 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4758 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 796.0602 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 671.9921 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 903.7717 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.47131 | 3 | 1 | 24601666 | | Mascot_Score | 59.57 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 948.4469 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.47314 | 3 | 1 | 24601666 | | Mascot_Score | 39.92 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 820.71 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 855.60535 | 4 | 1 | 19376835 | -0.692038 | Mascot_Score | 38.5 | 22 days | total protein | col-0 | 8h light/16h dark | in-solution | TiO2 or Fe-IMAC | trypsin | | LTQ-Orbitrap | seedlings | |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4714 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.470562 | 3 | 1 | 23111157 | 0.0201924 | XCorr | 5.56 | 9 days | total protein | col-0 | continuous light | in-solution | Ti-IMAC | trypsin | | LTQ | seedlings | nitrate starvation / nitrate resupply |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4707 | 3 | 1 | 24601666 | | Mascot_Score | 23.03 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 747.7867 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4694 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.47034 | 3 | 1 | 24601666 | | Mascot_Score | 17.96 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 809.0657 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4714 | 3 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 581.2916 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 626.7807 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 801.7258 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1238.1713 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 671.995 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4731 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 887.7846 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4713 | 3 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.4717 | 3 | | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 1140.46887 | 3 | 1 | 24601666 | | Mascot_Score | 27.67 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 626.7806 | 4 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 747.7861 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 820.7076 | 3 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 855.6048 | 4 | 1 | 24601666 | | Mascot_Score | 34.94 | 4 weeks | total protein | col-0 | 16h light/8h dark | in-solution | IMAC | trypsin | | LTQ-Orbitrap XL ETD | seedlings | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 747.7869 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |
| YGGDAGDRSPTHYPQAEEGEDEDEVNNLFK | YGGDAGDR(pS)PTHYPQAEEGEDEDEVNNLFK | 898.4031 | 2 | 1 | 29167316 | | Mascot_Score | 0 | 14 days | total protein | col-0 and mpk mutants | | in-solution | Fe-IMAC | trypsin | | | | flg22 |